DEV

You are viewing our development site. Please share feedback with support@dosevault.ai or on our Discord server. See what is new in the changelog.

LL-37

LL-37 is the only known human cathelicidin antimicrobial peptide, derived from the C-terminus of the precursor protein hCAP18 by serine protease cleavage. It has been studied for its broad-spectrum antimicrobial activity, immunomodulatory properties, and roles in wound healing. Research indicates it modulates NF-kB signaling, promotes angiogenesis at wound sites, and plays a role in gut mucosal immunity.

Molecular Profile
linear
37 AA Sequence
Evidence grade (Limited): Mostly preclinical or low-quality human studies. This grade reflects the overall quality of available research on this compound and does not constitute a clinical recommendation.
CAS
154947-66-7
Mol. weight
4493 g/mol
Formula
C205H340N60O53
Chain length
37 aa
Sequence
[LL-37, 37 aa]
Onset and duration

Onset and duration vary by individual; see the mechanism and half-life above.

Storage and reconstitution

Store the lyophilized powder refrigerated (2 to 8 C), or frozen for long-term storage, protected from light. After reconstitution with bacteriostatic water, keep refrigerated and use within about 4 weeks.

Clinical Evidence

What the literature says

Scientific Overview

Sole human cathelicidin. Investigated for SIBO, chronic Lyme, and biofilm-forming infections; cytotoxic at high concentrations.

Pharmacokinetics

Half-life (t½)
1.0 h
Approximate plasma half-life
Routes
Subcutaneous

Last reviewed: 2026-05-09

Research Guide

How users approach this compound

The following reflects patterns observed in research literature and community protocols. This is not medical advice and does not constitute a clinical recommendation.

Typical Dose Range Observed

500–2000 mcg
subcutaneous or topical

Research Protocols

Common Dosages

Antimicrobial Cycle

100–300 mcg
Daily (5 on / 2 off)

Cycle 2–4 weeks

Dosages listed are common research protocols found in peer-reviewed literature and clinical trials. Individual results and requirements may vary significantly in a research context.

Reported Uses

  • Studied for antimicrobial activity against bacteria, fungi, and viruses in vitro
  • Investigated for wound healing and skin barrier modulation in preclinical models
  • Explored for intestinal disease and gut mucosal immunity applications

Key Research Benefits

  • Broad antimicrobial
  • Biofilm disruption
  • Immune modulation

Potential Side Effects

Histamine release (high doses)
Site reaction

Considerations and Cautions

  • Potential pro-inflammatory effects at high systemic doses
  • Very limited controlled human safety data

Labs to monitor

Educational context only, not a testing mandate. Any bloodwork decisions belong with your clinician.

  • No validated compound-specific markers: No standard bloodwork is established for this compound; general safety labs (CBC, comprehensive metabolic panel) are reasonable if used under medical supervision.

Dose Calculator

Peptide Reconstitution Calculator

mg

Total amount of peptide in the vial.

mL

Volume of water used to mix.

mcg

Draw to this mark

8 Units

or 0.08 mL on a U-100 syringe

Concentration:2.50 mg/mL
Peptide per Unit:25.00 mcg/unit
*Always double-check your calculations. This tool is for educational purposes only.

Related Tools

Not medical advice

Information on DoseVault is for educational purposes only and is not a substitute for medical advice, diagnosis, or treatment from a qualified healthcare provider.