DEV

You are viewing our development site. Please share feedback with support@dosevault.ai or on our Discord server. See what is new in the changelog.

Sermorelin

Sermorelin (GHRH 1-29 NH2) corresponds to the first 29 amino acids of endogenous growth hormone-releasing hormone and has been studied for its ability to stimulate pulsatile GH secretion from the anterior pituitary. It is FDA-approved as a diagnostic agent for GH deficiency and has been prescribed off-label for adult GH deficiency. Unlike synthetic GH, it acts upstream at the hypothalamic-pituitary axis, preserving endogenous feedback.

Molecular Profile
linear
29 AA Sequence
Evidence grade (Moderate): Small clinical studies or well-designed non-RCT human research. This grade reflects the overall quality of available research on this compound and does not constitute a clinical recommendation.
CAS
86168-78-7
Mol. weight
3357.9 g/mol
Formula
C149H246N44O42S
Chain length
29 aa
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (GRF 1-29)
Onset and duration

Acute growth-hormone pulse within roughly 30 to 60 minutes of dosing; body-composition effects build over weeks.

Storage and reconstitution

Store the lyophilized powder refrigerated (2 to 8 C), or frozen for long-term storage, protected from light. After reconstitution with bacteriostatic water, keep refrigerated and use within about 4 weeks.

Clinical Evidence

What the literature says

Scientific Overview

Sermorelin corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone (GHRH).

Pharmacokinetics

Half-life (t½)
10 min
Approximate plasma half-life
Routes
Subcutaneous
Plasma decay
100%~3%@ 5× t½

t½ 12 min · ~3% remaining at 1.0 h

Last reviewed: 2026-05-09

Research Guide

How users approach this compound

The following reflects patterns observed in research literature and community protocols. This is not medical advice and does not constitute a clinical recommendation.

Typical Dose Range Observed

200–500 mcg
subcutaneous injection at bedtime

Research Protocols

Common Dosages

Natural Pulse

200-500 mcg
Daily (at bedtime)

Mimics natural GH release cycle

Dosages listed are common research protocols found in peer-reviewed literature and clinical trials. Individual results and requirements may vary significantly in a research context.

Reported Uses

  • Studied for stimulation of physiologic growth hormone pulses
  • Investigated as an off-label alternative to recombinant GH for adults with GH deficiency
  • Explored for age-related body composition and sleep quality research

Key Research Benefits

  • Increases lean body mass
  • Improves sleep quality
  • Reduces body fat
  • Enhances immune function

Potential Side Effects

Flushing
Headache
Nausea
Injection site reactions

Considerations and Cautions

  • Contraindicated in confirmed active neoplasia
  • Use in pregnancy not established

Labs to monitor

Educational context only, not a testing mandate. Any bloodwork decisions belong with your clinician.

  • IGF-1: Primary downstream marker of growth-hormone-axis activity.
  • Fasting glucose / HbA1c: GH-axis stimulation can reduce insulin sensitivity over time.

Dose Calculator

Peptide Reconstitution Calculator

mg

Total amount of peptide in the vial.

mL

Volume of water used to mix.

mcg

Draw to this mark

10 Units

or 0.10 mL on a U-100 syringe

Concentration:2.50 mg/mL
Peptide per Unit:25.00 mcg/unit
*Always double-check your calculations. This tool is for educational purposes only.

Quick Explainer

Sermorelin is a GHRH analogue that works by stimulating the pituitary gland to release its own natural growth hormone, supporting youthfulness and vitality.

Stack Sermorelinwith…

Curated stacking partners researched alongside Sermorelin. Each link opens a dedicated stack page with combined benefits, side-effect overlap, and half-life considerations.

Sermorelin by goal

Read Sermorelin's profile filtered through specific research goals.

Related Tools

Not medical advice

Information on DoseVault is for educational purposes only and is not a substitute for medical advice, diagnosis, or treatment from a qualified healthcare provider.