DEV

You are viewing our development site. Please share feedback with support@dosevault.ai or on our Discord server. See what is new in the changelog.

Metabolic

Exenatide

First-in-class GLP-1 mimetic derived from Gila monster venom; sold as Byetta/Bydureon.

Molecular Profile
linear
39 AA Sequence
CAS
141758-74-9
Mol. weight
4187 g/mol
Formula
C184H282N50O60S
Chain length
39 aa
Sequence
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Onset and duration

Appetite or glycemic effects within the first days; full effect accrues over weeks to months alongside titration.

Storage and reconstitution

Store the lyophilized powder refrigerated (2 to 8 C), or frozen for long-term storage, protected from light. After reconstitution with bacteriostatic water, keep refrigerated and use within about 4 weeks.

Clinical Evidence

What the literature says

Scientific Overview

Exenatide is a 39-aa synthetic version of exendin-4 from Heloderma suspectum (Gila monster) saliva. It was the first GLP-1 receptor agonist FDA-approved (Byetta, 2005, Amylin/Lilly), with a microsphere weekly formulation Bydureon following in 2012. Largely displaced by liraglutide, semaglutide, and tirzepatide.

Research Guide

How users approach this compound

The following reflects patterns observed in research literature and community protocols. This is not medical advice and does not constitute a clinical recommendation.

Research Protocols

Common Dosages

T2DM

5-10 mcg BID (Byetta) / 2 mg weekly (Bydureon)
Per formulation

Within 60 min before meals (Byetta)

Dosages listed are common research protocols found in peer-reviewed literature and clinical trials. Individual results and requirements may vary significantly in a research context.

Key Research Benefits

  • HbA1c reduction
  • Modest weight loss
  • Long-acting weekly form available

Potential Side Effects

Nausea
Pancreatitis (rare)
Injection-site nodules (Bydureon)

Labs to monitor

Educational context only, not a testing mandate. Any bloodwork decisions belong with your clinician.

  • HbA1c: Primary glycemic efficacy marker for incretin therapy.
  • Fasting glucose: Tracks glycemic response and hypoglycemia risk in combination therapy.
  • Lipid panel / ApoB: Incretin therapy commonly improves atherogenic lipids alongside weight loss.

Dose Calculator

Peptide Reconstitution Calculator

mg

Total amount of peptide in the vial.

mL

Volume of water used to mix.

mcg

Draw to this mark

0.2 Units

or 0.00 mL on a U-100 syringe

Concentration:2.50 mg/mL
Peptide per Unit:25.00 mcg/unit
*Always double-check your calculations. This tool is for educational purposes only.

Exenatide by goal

Read Exenatide's profile filtered through specific research goals.

Related Tools

Not medical advice

Information on DoseVault is for educational purposes only and is not a substitute for medical advice, diagnosis, or treatment from a qualified healthcare provider.