DEV

You are viewing our development site. Please share feedback with support@dosevault.ai or on our Discord server. See what is new in the changelog.

DOSEVAULT
Metabolic

Lixisenatide

Short-acting prandial GLP-1 agonist; sold as Adlyxin/Lyxumia by Sanofi.

Molecular Profile
linear
44 AA Sequence
CAS
320367-13-3
Mol. weight
4858.6 g/mol
Formula
C215H347N61O65S
Chain length
44 aa
Sequence
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2
Onset and duration

Appetite or glycemic effects within the first days; full effect accrues over weeks to months alongside titration.

Storage and reconstitution

Store the lyophilized powder refrigerated (2 to 8 C), or frozen for long-term storage, protected from light. After reconstitution with bacteriostatic water, keep refrigerated and use within about 4 weeks.

Clinical Evidence

What the literature says

Scientific Overview

Lixisenatide is an exendin-4 analog with a six-lysine C-terminal extension. Approved in the EU (2013, Lyxumia) and US (2016, Adlyxin) by Sanofi. Short half-life (~3h) makes it more effective for postprandial glucose than fasting glucose. ELIXA trial showed CV neutrality. Discontinued in the US in 2023 due to low uptake.

Citations (4)

  1. Lixisenatide, a novel GLP-1 receptor agonist: efficacy, safety and clinical implications for type 2 diabetes mellitusPubMed
  2. Lixisenatide in type 1 diabetes: A randomised control trial of the effect of lixisenatide on post-meal glucose excursions and glucagon in type 1 diabetes patientsPubMed
  3. Efficacy and safety of the once-daily GLP-1 receptor agonist lixisenatide in monotherapy: a randomized, double-blind, placebo-controlled trial in patients with type 2 diabetes (GetGoal-Mono)PubMed
  4. Lixisenatide in type 2 diabetes: latest evidence and clinical usefulnessReview

Research Guide

How users approach this compound

The following reflects patterns observed in research literature and community protocols. This is not medical advice and does not constitute a clinical recommendation.

Research Protocols

Common Dosages

T2DM

10 -> 20 mcg
Daily SC

“Within 1h before first meal”

Dosages listed are common research protocols found in peer-reviewed literature and clinical trials. Individual results and requirements may vary significantly in a research context.

Key Research Benefits

  • Strong postprandial glucose control
  • Modest weight loss
  • Daily dosing

Potential Side Effects

Nausea
Hypoglycemia (with sulfonylureas)
Injection-site reaction

Labs to monitor

Educational context only, not a testing mandate. Any bloodwork decisions belong with your clinician.

  • HbA1c: Primary glycemic efficacy marker for incretin therapy.
  • Fasting glucose: Tracks glycemic response and hypoglycemia risk in combination therapy.
  • Lipid panel / ApoB: Incretin therapy commonly improves atherogenic lipids alongside weight loss.

Dose Calculator

Peptide Reconstitution Calculator

mg

Total amount of peptide in the vial.

mL

Volume of water used to mix.

mcg

Draw to this mark

0.4 Units

or 0.00 mL on a U-100 syringe

Concentration:2.50 mg/mL
Peptide per Unit:25.00 mcg/unit
*Always double-check your calculations. This tool is for educational purposes only.

Lixisenatide by goal

Read Lixisenatide's profile filtered through specific research goals.

Lixisenatide for Fat Loss

Related Tools

Not medical advice

Information on DoseVault is for educational purposes only and is not a substitute for medical advice, diagnosis, or treatment from a qualified healthcare provider.