DEV

You are viewing our development site. Please share feedback with support@dosevault.ai or on our Discord server. See what is new in the changelog.

VIP (Vasoactive Intestinal Peptide)

VIP is a 28-amino-acid member of the secretin/glucagon peptide family that signals through the VPAC1 and VPAC2 G-protein-coupled receptors. It drives smooth-muscle relaxation and vasodilation, stimulates pulmonary surfactant, and broadly downregulates pro-inflammatory cytokine production. It is degraded within minutes in circulation, with the lung acting as a major site of uptake and clearance, which is why sustained therapeutic use requires infusion or alternative delivery.

Molecular Profile
linear
28 AA Sequence
Evidence grade (Limited): Mostly preclinical or low-quality human studies. This grade reflects the overall quality of available research on this compound and does not constitute a clinical recommendation.
CAS
40077-57-4
Mol. weight
3326.8 g/mol
Formula
C147H237N43O43S
Chain length
28 aa
Sequence
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Onset and duration

Onset and duration vary by individual; see the mechanism and half-life above.

Storage and reconstitution

Store the lyophilized powder refrigerated (2 to 8 C), or frozen for long-term storage, protected from light. After reconstitution with bacteriostatic water, keep refrigerated and use within about 4 weeks.

Clinical Evidence

What the literature says

Scientific Overview

According to PubMed, a multicenter randomized trial of IV aviptadil (synthetic VIP) in critical COVID-19 respiratory failure did NOT meet its primary endpoint, though it showed a secondary survival signal and reduced IL-6 (Youssef JG et al., Crit Care Med 2022). VIP is cleared extremely fast: a rat study measured a plasma half-life of about 0.4 minutes, with the lungs as a major clearance site (Hassan M et al., Nucl Med Biol 1994). The intranasal off-label CIRS use is anecdotal and not supported by controlled trials.

Pharmacokinetics

Half-life (t½)
1 min
Approximate plasma half-life
Routes
IntravenousIntranasal

Last reviewed: 2026-06-15

Research Guide

How users approach this compound

The following reflects patterns observed in research literature and community protocols. This is not medical advice and does not constitute a clinical recommendation.

Research Protocols

Common Dosages

Aviptadil (IV, trial)

Per protocol
IV infusion over 3 days (trial)

Investigational; hospital/research setting

Intranasal (off-label)

Not established
Per protocol

Off-label CIRS use; no controlled-trial dosing

Dosages listed are common research protocols found in peer-reviewed literature and clinical trials. Individual results and requirements may vary significantly in a research context.

Reported Uses

Key Research Benefits

  • Anti-inflammatory and immune-modulating signaling
  • Upregulates pulmonary surfactant and protects alveolar cells (preclinical, aviptadil)
  • Off-label intranasal use reported for chronic inflammatory response and sinopulmonary symptoms (not established)

Potential Side Effects

Hypotension
Flushing
Diarrhea
Infusion-related reactions (IV aviptadil)

Considerations and Cautions

  • Hypotension or hemodynamic instability (IV)
  • Hypersensitivity to the peptide
  • No established safety profile for off-label intranasal use

Labs to monitor

Educational context only, not a testing mandate. Any bloodwork decisions belong with your clinician.

  • Blood pressure: VIP is a vasodilator; IV use can cause hypotension.
  • Inflammatory markers (e.g., IL-6, CRP): Used as research endpoints for its anti-inflammatory effect.

Dose Calculator

Peptide Reconstitution Calculator

mg

Total amount of peptide in the vial.

mL

Volume of water used to mix.

mcg

Draw to this mark

10 Units

or 0.10 mL on a U-100 syringe

Concentration:2.50 mg/mL
Peptide per Unit:25.00 mcg/unit
*Always double-check your calculations. This tool is for educational purposes only.

VIP (Vasoactive Intestinal Peptide) by goal

Read VIP (Vasoactive Intestinal Peptide)'s profile filtered through specific research goals.

Related Tools

Not medical advice

Information on DoseVault is for educational purposes only and is not a substitute for medical advice, diagnosis, or treatment from a qualified healthcare provider.